PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00156118001
Common NameGSBRNA2T00156118001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 93aa    MW: 10653.6 Da    PI: 10.2342
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00156118001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26050.56.1e-16177344100
               DUF260  44 kllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                          k+l+++++++r++ ++sl++eAear+rdPvyG+vg+i+ lq++ ++l+  l+ +k+e
  GSBRNA2T00156118001  17 KILNEIDPSQRQACVDSLCFEAEARIRDPVYGCVGIIRGLQRRRQHLQLSLNIAKRE 73 
                          899*********************************************999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.165174IPR004883Lateral organ boundaries, LOB
PfamPF031959.3E-151771IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MEPCAICKEK RQKCTKKILN EIDPSQRQAC VDSLCFEAEA RIRDPVYGCV GIIRGLQRRR  60
QHLQLSLNIA KRELAMIKHG QIQQHLSVRS RL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00156118001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013460833.11e-21LOB domain protein
SwissprotO648361e-17LBD10_ARATH; LOB domain-containing protein 10
TrEMBLA0A078DVR42e-61A0A078DVR4_BRANA; BnaA06g05980D protein
STRINGGLYMA06G11181.17e-17(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23660.22e-16LOB domain-containing protein 10
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]